PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA6790
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family MYB_related
Protein Properties Length: 359aa    MW: 38428.8 Da    PI: 7.4444
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA6790genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.73.1e-14112156347
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               +WT+eE+ l++ + ++lG+g+W+ Iar +   Rt+ q+ s+ qky
  Tp57577_TGAC_v2_mRNA6790 112 PWTEEEHRLFLVGLHKLGKGDWRGIARNFVVSRTPTQVASHAQKY 156
                               8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.418105161IPR017930Myb domain
SuperFamilySSF466895.89E-17107162IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-18108160IPR006447Myb domain, plants
SMARTSM007171.5E-11109159IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-11109155IPR009057Homeodomain-like
PfamPF002496.0E-12112156IPR001005SANT/Myb domain
CDDcd001677.01E-10112157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPS RGSGGGGGGG VRLFGVRLTD GSIIKKSASM GNLNLAALHH  60
CSSSSSLNPG SSINPGSPCS DPPNDPDGYL SDDPAHASTF VSRRGERKKG VPWTEEEHRL  120
FLVGLHKLGK GDWRGIARNF VVSRTPTQVA SHAQKYFIRQ SNATRRKRRS SLFDMAPDMC  180
PDSTLMPEEQ VLLPPSENSQ PCNGKSQPSL NLSLKSEYEP METTSEENAE EGNETTMGSK  240
GSTPMTHGFF PSYVPVPFSI WPSIGAPFEE VNGGETSHHS HHQVLKPIPV IPKEPVNVDE  300
LVGMSHLSIG EAQVHDREPS PLSLKLLGEP SRQSAFHANA PVGGSDLNGG KNSAIQAV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003597679.10.0MYB-like transcription factor family protein
TrEMBLG7II010.0G7II01_MEDTR; MYB-like transcription factor family protein
STRINGGLYMA13G43120.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.13e-99MYB_related family protein